<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33485
| Description |
Uncharacterized protein |
| Sequence | MAANYWSSTQKTSWSFSRDKLASIRDEVEKPHAQLVHQHPYADRRLMFIFLRDRLLQLAKRLPFRQQCVATALVYMHRYFLSTPMQNVNLYLLTATAFYLASKTEESPHHIRIVASEARQAWPEFVPGDVSRLGEMEFCLISEMRSQLIVWHPYRTLIDLKDNQDLKLTSDELGLAWCIINDSYMTDLPLTCAPHLIAVIAMFLAVVFYPYTRSNAARPPGQDSLMGVDGNSFSSMGGRPGLAGVLGSAMHGLPMNPPTTAASANQSQTNGAGRPGASEPPRLITPDRAQTMAVIQQSEKFTNTIKFLVESDIDLKQMIDGTQEIISLYQVWEEFNEKAIKEAVSRCLKSNAIDT |
| Length | 355 |
| Position | Kinase |
| Organism | Cyphellophora europaea CBS 101466 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Cyphellophoraceae> Cyphellophora.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.196 |
| Instability index | 43.75 |
| Isoelectric point | 6.51 |
| Molecular weight | 39904.30 |
| Publications | |
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33485
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.00| 11| 32| 231| 241| 2
---------------------------------------------------------------------------
231- 241 (22.76/16.23) NSFSSMG.GRPG
265- 276 (18.23/11.61) NQSQTNGaGRPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.42| 13| 108| 32| 53| 3
---------------------------------------------------------------------------
32- 46 (21.76/21.42) HAQLVHQHPYadRRL
145- 157 (26.66/ 6.15) RSQLIVWHPY..RTL
---------------------------------------------------------------------------
|