<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33483
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSATQYPPKIPLSPSSPPETGVKRRRASETSPKLPPSPKYMSVATKSYVSHGTHTSHMDEAASRSSPRSPSSASSYTRPSTQRNSQPYSTPSSSHSEHHTSNMMERDEHRDKRQRIGEAMDLDESMLPTNHERRSKKEDEGTSPRLGDIEMQDSAGDPDLDELDKDIGEPYLSCRSRVEPQKPDVQTHLLSIYGLGSLQRSVARQDPFTQEKINKLRKSYEGQIKDFQLAGRNKAVKLKQEKPNEPSMRASIGSFTSETRGTYLQNTEEWEAANPKREIKVTDDFRSKLRKAMQMQPGRVRNEAKWDDVLGHEKKTAAPLAMASAQAAAQRPNGLMRPAPQSAAELKRQTRGKKRSYGDDSFIGYGEGYSEPEDASPDGEYGSDDGNRKKRRKVGF |
| Length | 396 |
| Position | Head |
| Organism | Cyphellophora europaea CBS 101466 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Cyphellophoraceae> Cyphellophora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.229 |
| Instability index | 63.40 |
| Isoelectric point | 9.30 |
| Molecular weight | 44339.62 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33483
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 132.08| 39| 56| 8| 61| 1
---------------------------------------------------------------------------
8- 60 (57.67/46.81) PKIPLSPSSPPETGVKRrrasETSPKLPPSPkymsvatkSYVSHgtHTSHMDE
67- 105 (74.41/30.00) PRSPSSASSYTRPSTQR....NSQPYSTPSS........SHSEH..HTSNMME
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 61.59| 18| 55| 226| 243| 2
---------------------------------------------------------------------------
172- 183 (15.13/ 6.69) ...........LSCRS.......RVEPQKP
184- 213 (16.21/ 7.67) DVQthllsiygLGSLQRSVarqdPFTQEKI
226- 243 (30.25/20.48) DFQ........LAGRNKAV....KLKQEKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.75| 13| 23| 108| 124| 3
---------------------------------------------------------------------------
115- 135 (10.42/13.63) RIGEaMDLDEsmlptnhERRS
145- 157 (21.32/ 8.60) RLGD.IEMQD.......SAGD
---------------------------------------------------------------------------
|