Description | Uncharacterized protein |
Sequence | MSSDILTQLQTCYDQLLIQFFSTISYHHRRHPLIAPDEIPGDAYSIPPKDAKLADGHSGRHKYVTYKLGPEDSDPDNMDLQPKSPNEFDQAQQDLAEDLVRKGQQIEYLIRRLPGIGTGEQEQNEEIQRLAEEVRNVERQRREKRKEMRECLKQLDNVVMGMSRSVNVPPDGRSDDAS |
Length | 178 |
Position | Middle |
Organism | Cyphellophora europaea CBS 101466 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Cyphellophoraceae> Cyphellophora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.985 |
Instability index | 71.31 |
Isoelectric point | 5.16 |
Molecular weight | 20459.58 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP33474 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) GRHKYVTYKLGPE 2) YLIRRL | 59 108 | 71 113 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab