Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MEGEGDSRVHFSEVSDPWSSSRHVAVLQALDAVEKKLVTALRTAATAMSLMAPRVASEESSSLAFNSTCTEFLQLVKEIHTELANHIHLVSDYRTFARSTYGAEKDMEICREKVKVVSEQLQTLSRFLEDHYTPEES |
Length | 137 |
Position | Head |
Organism | Phytophthora parasitica (strain INRA-310) |
Kingdom | Oomycetes |
Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae> Phytophthora. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.326 |
Instability index | 64.22 |
Isoelectric point | 5.20 |
Molecular weight | 15377.07 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33470 No repeats found |
MoRF Sequence | Start | Stop |
1) RFLEDHYTPEE 2) YRTFARSTY | 126 93 | 136 101 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab