<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33465
Description |
Uncharacterized protein |
Sequence | MQSGGDVDRALSSIRARADHLRHTVARLEHNLAWNPASTWPELLSQYMVISKQLENMNEEIPDLVQHFACVPRMSTPNPADIPLLLRTREDPEMEEEERQLMADKPRGKNTEALQKLVMAHNDAVESLEETFNEMSDGLLKAIRVNKYVVKSKPQSTQTQQFKYIESGTYE |
Length | 171 |
Position | Head |
Organism | Phytophthora parasitica (Potato buckeye rot agent) |
Kingdom | Oomycetes |
Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae>
Phytophthora.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.698 |
Instability index | 52.41 |
Isoelectric point | 5.31 |
Molecular weight | 19591.92 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33465
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.40| 15| 34| 56| 73| 1
---------------------------------------------------------------------------
56- 73 (22.70/23.04) NMNEEIPDLVQHfacVPR
93- 107 (26.69/16.23) EMEEEERQLMAD...KPR
---------------------------------------------------------------------------
|