Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAEVADEDLPTRWEIELEVSTNCWLLTYQFVQSLANMQYLTYLAQTGFLEDEKFLNYLEYLEYWRRPEYAKQLVYPNCLHVLTMLKSPQFRKDIAKAELSSVLYNDMVERWKEPLREPVKGAKEDPGTSGQEQPQSSPQIKIEDTPDVAQVSPVHGLK |
Length | 158 |
Position | Middle |
Organism | Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1) (Yeast) (Hansenula polymorpha) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Pichiaceae> Ogataea. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.552 |
Instability index | 61.88 |
Isoelectric point | 4.75 |
Molecular weight | 18418.68 |
Publications | PubMed=24279325 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33453 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 96.35| 20| 20| 54| 73| 1 --------------------------------------------------------------------------- 34- 52 (25.84/14.87) .LANMQYLTYLAQTGFLEDE 54- 73 (35.11/22.34) FLNYLEYLEYWRRPEYAKQL 75- 94 (35.39/22.57) YPNCLHVLTMLKSPQFRKDI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EPVKGAKEDP 2) QPQSSPQIKIEDTPDVAQVSPVH | 117 133 | 126 155 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab