<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33451
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MTSASNKNTFIYQQVDAFEGQLRELTNSIQQYEPSVEVAAKLVATMDTINQELTQLERLHELKRNQVFEQSKENLRLNDGMRNMLTSLIECRKELSDLPKLSTHEQLQLENSEETRKPKLDAVKELVAYAMKLAKFSKIPRTFDGFLLPNNFIWPGDDNMRRGMLATASLMPEKIVRHENGEPDEEEDIQMKDTEETQKQAVEDDDEFVPERRNSFKTSASPEKKDAAAIMAGIDLFDESDDD |
| Length | 243 |
| Position | Middle |
| Organism | Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1) (Yeast) (Hansenula polymorpha) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Pichiaceae> Ogataea.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.802 |
| Instability index | 43.08 |
| Isoelectric point | 4.67 |
| Molecular weight | 27905.94 |
| Publications | PubMed=24279325
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33451
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 214.52| 75| 81| 41| 121| 1
---------------------------------------------------------------------------
24- 107 (99.60/85.00) ELTNSIQQYEPSVEvaaKLVATMDTINQeLTQLERLHE..LKRNQVFEQSKENLRlnDGMRNMLTSLIE..CRKELSDlPklSTHEQL
108- 189 (114.91/75.80) QLENSEETRKPKLDavkELVAYAMKLAK.FSKIPRTFDgfLLPNNFIWPGDDNMR..RGMLATASLMPEkiVRHENGE.P..DEEEDI
---------------------------------------------------------------------------
|