| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MSLNFNDVPVQNLEQLRPRLTQLTHSLRKLEDSMAASATLPNWSNLQNQYNVILSQLTSFSRTMDLNKDVLKHTNVYPNTEFDTTQFEGLLTTLLRKKHLPEVAEWIENNMTDVSREDLAKDDQVAAEYLKLSEELLGEFSFDDNTPLEGSDKPETPGVDVYKYMFGGGAK |
| Length | 171 |
| Position | Head |
| Organism | Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1) (Yeast) (Hansenula polymorpha) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Pichiaceae> Ogataea. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.592 |
| Instability index | 35.05 |
| Isoelectric point | 4.65 |
| Molecular weight | 19473.55 |
| Publications | PubMed=24279325 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP33446
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.36| 20| 31| 12| 31| 1
---------------------------------------------------------------------------
12- 31 (33.98/21.77) NLE.QLRPRLTQLTHSLRKLE
45- 65 (30.38/18.85) NLQnQYNVILSQLTSFSRTMD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AEYLKLSEELLGEFSFD 2) TPLEGSDKPETPGVDVYKYMFGGGAK | 127 146 | 143 171 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab