<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33440
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MDTNDVPNASLQLLHQVEKRIVRVLELAGGVMEELANGTGPRMEVLNNYCPEFMQSIKEIQMMLWQEIKSACDYRPFEKCDYNSRISNEMCCKKLGMIIGRLDGMKQTIEEYNKAN |
Length | 116 |
Position | Head |
Organism | Amborella trichopoda |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Amborellales> Amborellaceae> Amborella.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.443 |
Instability index | 45.87 |
Isoelectric point | 5.20 |
Molecular weight | 13381.41 |
Publications | PubMed=24357323
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33440
No repeats found
No repeats found
|