<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33430
| Description |
Uncharacterized protein |
| Sequence | MEMEESLSRKSTEELAVEGQRHLEDTIAAAYQILCSMNQELCNPSLWSTADAADSSHHHEPGGGALEDARHRYKCAVASLRAVLSAIPTSHSEVPQGAGPTGSSPDTSGKKSELQSLEERAAYLRKELANKNKHLKLVIDQLRELVMDVSMWQSPCSV |
| Length | 158 |
| Position | Head |
| Organism | Amborella trichopoda |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Amborellales> Amborellaceae> Amborella.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.523 |
| Instability index | 52.50 |
| Isoelectric point | 5.47 |
| Molecular weight | 17270.16 |
| Publications | PubMed=24357323
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33430
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.98| 22| 31| 42| 63| 1
---------------------------------------------------------------------------
42- 63 (43.80/21.25) CN.PSLWSTADAADSSHHHEPGG
75- 97 (34.18/15.53) CAvASLRAVLSAIPTSHSEVPQG
---------------------------------------------------------------------------
|