<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33429
| Description |
Uncharacterized protein |
| Sequence | MPSGWKPGMPIGIGDIAIVPPGWKPGDPVPLPPVVDVPVGWKPGDAVVLPKPAKEAVPMVQKPIVSNAPEPIQVNFVQLDINPDQDDYSSEYSNDVGCSEEDDEERELGVRISVG |
| Length | 115 |
| Position | Middle |
| Organism | Amborella trichopoda |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Amborellales> Amborellaceae> Amborella.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.297 |
| Instability index | 48.91 |
| Isoelectric point | 4.09 |
| Molecular weight | 12277.77 |
| Publications | PubMed=24357323
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33429
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 89.50| 14| 15| 19| 32| 1
---------------------------------------------------------------------------
2- 14 (24.60/ 7.97) .PSGWKPGMPIGIG
19- 32 (34.42/13.39) VPPGWKPGDPVPLP
37- 50 (30.48/11.21) VPVGWKPGDAVVLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.65| 13| 15| 52| 64| 2
---------------------------------------------------------------------------
52- 64 (23.30/10.50) PAKEAVPMVQKPI
69- 81 (23.35/10.53) PEPIQVNFVQLDI
---------------------------------------------------------------------------
|