<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33412
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MPIFMGLAHMIALQQLARPKDLYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFVGYLKYLQYWQQPEYIKFIMYPHSLFFLELLQNANFRNAMAHPGNKEIAHRQQFFFWKNYRNNRLKHILPRPLPEPPAQPVPPPPPAPAPSTAANAPIPSPMQMTSSIGSTLPKPDMRNSSGDRRKRKRFRHPSKVKGPLAMRVPGCPPKRPDLPRHGCLGL |
| Length | 225 |
| Position | Middle |
| Organism | Amborella trichopoda |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Amborellales> Amborellaceae> Amborella.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.608 |
| Instability index | 60.47 |
| Isoelectric point | 9.97 |
| Molecular weight | 26066.07 |
| Publications | PubMed=24357323
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP33412
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.55| 26| 62| 124| 151| 1
---------------------------------------------------------------------------
124- 151 (49.35/24.71) RNNRLKHilPRPLPEPPAQPVPP.PPPAP
189- 215 (46.19/18.55) KRKRFRH..PSKVKGPLAMRVPGcPPKRP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.39| 23| 38| 38| 60| 2
---------------------------------------------------------------------------
38- 60 (42.82/27.43) EFVQCLANPTYIHYLA..QNRYFED
77- 101 (37.57/23.29) EYIKFIMYPHSLFFLEllQNANFRN
---------------------------------------------------------------------------
|