<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33399

Description Uncharacterized protein
SequenceMNNPSLREEEKEVVPSDNGAGSSRPSSEKPKALPPPSPNSEGEGAIEVEKKKHEGPSTEEASMAGTVFSIHLHQTPSNLRHKMSVPELCRNFSAVAWCGKLNVIACASETCARIPSSNVKPPFWIPIHIVNPERPTEHAVFDVPADSPRDSVQFLEWSPISCPRALLVANFQGRITIWTQPSQGAVNLVRAVNCWHCEHEWRQDLAVVTKWLSGMSLYRWPPSNSSNSSSKMTFEERFLSYQQQASARWPNFLCVCSVFSSGSVQLHWSQCPPLQVDTSPKWFSTSKAVLGAGPSGIMAADAIITEAGTMHVAGVPIVNPSTVVVWEVTPGPGNSLQATTKANSGNGIPPFVNPPSWTGFAPLAAYLFSWQEYLVAEGKQSQKQTDQDMNQTVSLHCSPVSNFSAYVSPEAASQATTTWGSGVTAVAFDPARGGSVIAVVIIEGQYMSPYDPDEGPSITGWRVQIWESSLQPVVLHPLFENSASNFGGQPPMQTVWQTKVNKSIPPRSDIKGPQTPPMTGNLPDERNSTETGALKANILSFDPYDLPSDVRILAQIVFSGHGGEVAVAFLLGEVRLFSGANFSPVDYYNVNVGSTIAAPAFSSSSCCLASVWHDTSRDCTVLKIIRVLPPAVLSIQAKANSATWERAIADRLWWSLMAGVDWWDAVGCTQSAAEDGIVYLNSVIAVLDSDFHSLPSIQHRQQYGTGLDRIKCRLLEGTVAQDVRALVLDMQARLLLDMLGKGIESSLINPSALLSEPWLASGETLSGLGADAMAVEPQLVPCIQGYVDAVLDLASHFLTRLRRYASFCRTLASHANAGSARSMVASPSHSSAQTTSQGSQSGSSNTTGSTQMQAWVQGAIAKISNTSDGSSSLTPNPMGGHTPFMPISINTGTFPGTPAVRLIGDCHFLHKLCQLLLFCLFFRRRQWPRATGPTLRNPETNPLKPQTVAAGGGKGLEETNNVGARPSAPVSLKPEEGQASRVGQLIPGAKGLEEVSGGRPLRLGSGNAGQGYTSEEVKVLFLVLADLCKRTASLPHPLPQSQVGGASNIIIRLHYIDGNYTVLPEVVEASLGPHMQNLPRPRGADAAGLLLRELELHPPAEEWHKRNMFGGPWSELEEDQTPSLRSTSSVAEPWEFDSSQDYDSYNGVQGLWPRKRRLSERDAAFGLKTSVGLGGYLGLMGSRRDVIMAVWKTGLEGVWHKCIRCLRQTSALALPGPTNPQSDREAWWISRWAYGCPMCGGPWVRVV
Length1247
PositionTail
OrganismAmborella trichopoda
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Amborellales> Amborellaceae> Amborella.
Aromaticity0.08
Grand average of hydropathy-0.205
Instability index49.49
Isoelectric point6.30
Molecular weight134819.04
Publications
PubMed=24357323

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblPlants

GO - Biological Function
GO - Biological Process
circadian regulation of gene expression	GO:0032922	IEA:EnsemblPlants
positive regulation of plant-type cell wall cellulose biosynthetic process	GO:2001011	IEA:EnsemblPlants
positive regulation of systemic acquired resistance	GO:1901672	IEA:EnsemblPlants
regulation of cell wall pectin metabolic process	GO:1902066	IEA:EnsemblPlants
regulation of ethylene-activated signaling pathway	GO:0010104	IEA:EnsemblPlants
regulation of jasmonic acid mediated signaling pathway	GO:2000022	IEA:EnsemblPlants
regulation of long-day photoperiodism, flowering	GO:0048586	IEA:EnsemblPlants
regulation of transcription, DNA-templated	GO:0006355	IBA:GO_Central
response to osmotic stress	GO:0006970	IEA:EnsemblPlants
root development	GO:0048364	IEA:EnsemblPlants
trichome branching	GO:0010091	IEA:EnsemblPlants
trichome papilla formation	GO:1905499	IEA:EnsemblPlants









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33399
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.80|      10|     108|     151|     163|       1
---------------------------------------------------------------------------
  151-  163 (13.22/15.96)	SVQfLEWSpiSCP
  263-  272 (23.58/11.14)	SVQ.LHWS..QCP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     152.36|      43|     108|     766|     808|       2
---------------------------------------------------------------------------
  766-  808 (75.59/45.50)	SGLGADAMAVEPQLVP......CIQGYVDAVLDLASHFLTRLRRYASFC
  871-  919 (76.77/46.33)	SSLTPNPMGGHTPFMPisintgTFPGTPAVRLIGDCHFLHKLCQLLLFC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.93|      10|      31|     314|     326|       3
---------------------------------------------------------------------------
  314-  326 (16.82/13.22)	GV.PIVNPSTvvvW
  347-  357 (19.11/ 7.54)	GIpPFVNPPS...W
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     109.18|      31|     108|     378|     430|       4
---------------------------------------------------------------------------
  391-  421 (56.23/56.34)	QTVSLHCSPVSNFSAYVSPEAASQATTTWGS
  809-  839 (52.95/16.17)	RTLASHANAGSARSMVASPSHSSAQTTSQGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.56|      17|      19|      15|      31|       6
---------------------------------------------------------------------------
   15-   31 (31.12/19.39)	PSDNGAGSSRPSSEKPK
   36-   52 (28.44/16.95)	PSPNSEGEGAIEVEKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.31|      27|      33|     952|     980|       7
---------------------------------------------------------------------------
  952-  980 (44.14/27.01)	GGKGLEETNnvGARPSAPVSLKPEEGQAS
  988- 1014 (49.17/24.92)	GAKGLEEVS..GGRPLRLGSGNAGQGYTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.15|      19|      30|     242|     262|       9
---------------------------------------------------------------------------
  242-  262 (31.32/19.76)	QQQASARWpnFLCVCSVFSSG
  275-  293 (33.83/15.32)	QVDTSPKW..FSTSKAVLGAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.70|      21|      23|     428|     449|      10
---------------------------------------------------------------------------
  428-  449 (33.59/23.21)	FDPARGGSVIA..VVIIEGQyMSP
  450-  472 (36.11/19.83)	YDPDEGPSITGwrVQIWESS.LQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.11|      14|      22|     546|     559|      13
---------------------------------------------------------------------------
  546-  559 (23.41/13.34)	LPSDVRILAQIVFS
  570-  583 (23.70/13.59)	LLGEVRLFSGANFS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33399 with Med16 domain of Kingdom Viridiplantae
Unable to open file!