<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33395

Description Uncharacterized protein
SequenceMQCGGRGGGGGFRGRGDGGGGRGRGRGGPGGDRGGRGRGGGARGGRGGRGRGSMRGGLKVVVEPHRHDGVFIAKGKEDALVTKNMVTGESVYGEKRIAVQNEDGTKVEYRVWNPFRSKLAAAILSGVDNIWISPGSRVLYLGAASGTTVSHVSDLVGPNGIVYAVEFSNRSGRDLVNMAKKRTNVIPIIEDARHPSRYRMLVGMVDVIFSDVAQPDQARILGLNASYFLKNEGYFVISIKANCIDSTVPAEAVFVQEVRKLKEEKFKPMEQVTLEPFERDHACVVGAYRVPKKEKPGNAA
Length300
PositionUnknown
OrganismAmborella trichopoda
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Amborellales> Amborellaceae> Amborella.
Aromaticity0.07
Grand average of hydropathy-0.402
Instability index24.38
Isoelectric point9.94
Molecular weight32083.16
Publications
PubMed=24357323

Function

Annotated function 
GO - Cellular Component
box C/D RNP complex	GO:0031428	IBA:GO_Central
Cajal body	GO:0015030	IBA:GO_Central
small-subunit processome	GO:0032040	IBA:GO_Central

GO - Biological Function
histone-glutamine methyltransferase activity	GO:1990259	IBA:GO_Central
RNA binding	GO:0003723	IBA:GO_Central
rRNA methyltransferase activity	GO:0008649	IBA:GO_Central

GO - Biological Process
box C/D RNA 3'-end processing	GO:0000494	IBA:GO_Central
histone glutamine methylation	GO:1990258	IBA:GO_Central
rRNA methylation	GO:0031167	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33395
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.85|      19|      19|       5|      23|       1
---------------------------------------------------------------------------
    5-   23 (44.64/15.07)	GRGGGGGFR.GRGDGGGGRG
   25-   44 (39.21/12.41)	GRGGPGGDRgGRGRGGGARG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.33|      16|      17|     188|     204|       2
---------------------------------------------------------------------------
  188-  204 (26.06/20.29)	IIEDARHPSRYRMLvGM
  208-  223 (27.27/16.30)	IFSDVAQPDQARIL.GL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.45|      18|      21|     117|     134|       3
---------------------------------------------------------------------------
  117-  134 (30.57/21.04)	SK...LAAAILSGVDNI..WISP
  136-  158 (19.88/11.35)	SRvlyLGAASGTTVSHVsdLVGP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33395 with Med36 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MQCGGRGGGGGFRGRGDGGGGRGRGRGGPGGDRGGRGRGGGARGGRGGRGRGSMRGGLKV
1
60










Molecular Recognition Features






MoRF SequenceStartStop




1) GGFRGRGDGGGGRGRGRGGPGGDRGGRGRG
10
39