Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MEIENETKPLSEQPAVQDAELPPVTKEEQGQEPEQDKVQVQEKEEQPDLEKVEQPALEKDEQQSPGETQKSQDLQEIQDNVLYKIHEILTKHSSTQSEFIPQLYHSLKLISKQPNNSSNSLDAATSSIRHRLKTAKALLQQDPQAIELLSKTPEQWQAHILEKRAELEKKKQHLQRLRENVQKQ |
Length | 184 |
Position | Middle |
Organism | Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275) (Yeast) (Candida kefyr) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kluyveromyces. |
Aromaticity | 0.02 |
Grand average of hydropathy | -1.207 |
Instability index | 79.18 |
Isoelectric point | 5.16 |
Molecular weight | 21263.41 |
Publications | PubMed=25834639 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33387 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 113.76| 31| 32| 12| 42| 1 --------------------------------------------------------------------------- 25- 57 (45.33/19.89) TKEEQGQE...PE.QDKVQ.VQEkeEQPDL.EKVEQPAL 58- 85 (31.45/11.73) EKDEQQSP...GE.TQKSQdLQE.......iQDNVLYKI 90- 124 (36.98/14.98) TKHSSTQSefiPQlYHSLK.LIS..KQPNN.SSNSLDAA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FIPQLYHSLKLISK 2) NETKPLSEQPAVQDAELPPVTKEEQGQEPEQDKVQVQEKEEQPDLEKVEQPALE | 99 5 | 112 58 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab