<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33387
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MEIENETKPLSEQPAVQDAELPPVTKEEQGQEPEQDKVQVQEKEEQPDLEKVEQPALEKDEQQSPGETQKSQDLQEIQDNVLYKIHEILTKHSSTQSEFIPQLYHSLKLISKQPNNSSNSLDAATSSIRHRLKTAKALLQQDPQAIELLSKTPEQWQAHILEKRAELEKKKQHLQRLRENVQKQ |
| Length | 184 |
| Position | Middle |
| Organism | Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275) (Yeast) (Candida kefyr) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -1.207 |
| Instability index | 79.18 |
| Isoelectric point | 5.16 |
| Molecular weight | 21263.41 |
| Publications | PubMed=25834639
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33387
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 113.76| 31| 32| 12| 42| 1
---------------------------------------------------------------------------
25- 57 (45.33/19.89) TKEEQGQE...PE.QDKVQ.VQEkeEQPDL.EKVEQPAL
58- 85 (31.45/11.73) EKDEQQSP...GE.TQKSQdLQE.......iQDNVLYKI
90- 124 (36.98/14.98) TKHSSTQSefiPQlYHSLK.LIS..KQPNN.SSNSLDAA
---------------------------------------------------------------------------
|