<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33386
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTDIEESESSYPNYYYYVDPTLPVYEPQQPNPVDDLISVYGLEEVARQVARTNPDGTKAVKLRKSYKNQIQDLSGRFLTIPSRENGKGGDISHVIFQNNPDMVNHVKLVDNMSEEEYRSAMMNRDTALFEPPQMDWDMCSTVIGQLMKSHPSEFKNAGFDVDDLAFDLNGTGTKTKKRKYKSNGSSMASPNAELQQDDMKRRRLE |
| Length | 205 |
| Position | Head |
| Organism | Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275) (Yeast) (Candida kefyr) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.875 |
| Instability index | 47.83 |
| Isoelectric point | 5.10 |
| Molecular weight | 23388.84 |
| Publications | PubMed=25834639
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
transcription open complex formation at RNA polymerase II promoter GO:0001113 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP33386
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.57| 10| 113| 53| 67| 1
---------------------------------------------------------------------------
53- 62 (18.59/19.60) NPDGTKAVKL
99- 108 (19.98/ 6.83) NPDMVNHVKL
---------------------------------------------------------------------------
|