<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33383
Description |
Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MQLIKGIQDLLVITRTIREKWVLSQLPENEESSMFESEETLENCKNLIQQAMDTLREDIS |
Length | 60 |
Position | Head |
Organism | Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275) (Yeast) (Candida kefyr) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.438 |
Instability index | 45.79 |
Isoelectric point | 4.37 |
Molecular weight | 7038.96 |
Publications | PubMed=25834639
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33383
No repeats found
No repeats found
|