<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33378
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSTPMRIASSTSVVTQPVSGQERIGEELQSVGIYQDLERYEETIQKLSESVDSFKPDLSLITKIIECDRNLYKTLEGFHEYYKIKIELDKLEEEQKEIGRKTKFMLENLNSCFQSLNELPMLEQVEFEQETMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMVGPNNFIWPAEDSLRKGMLAMASLKKKELLGAALDDDNNDDDGNANIDEANKQTEGSPKPEEEDVAKERRGSYEFAANGKEQSDDKPEGDADLELDLDLDLFNPDEF |
| Length | 272 |
| Position | Middle |
| Organism | Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275) (Yeast) (Candida kefyr) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.781 |
| Instability index | 46.70 |
| Isoelectric point | 4.53 |
| Molecular weight | 31141.51 |
| Publications | PubMed=25834639
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP33378
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.62| 10| 35| 33| 42| 1
---------------------------------------------------------------------------
33- 42 (18.24/10.97) IYQDLERYEE
71- 80 (18.38/11.10) LYKTLEGFHE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.47| 12| 25| 215| 226| 2
---------------------------------------------------------------------------
215- 226 (21.92/11.07) ANKQTEGSPKPE
242- 253 (21.55/10.78) ANGKEQSDDKPE
---------------------------------------------------------------------------
|