<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33374
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MHTLQLSHKSNETITIKNQSAIITPTHVHKDLYDNGCVFGTPEPFDYMLSNKLSNIWTQRQSIKGEFGVTYHTADLVIRTNNAFSYSGFQGLILEIESKSLNSFESFKKNFEKVQGMLHEMGLKDVKVSLDKFQKLDTTENFNLFDLAFQYLKVLG |
| Length | 156 |
| Position | Head |
| Organism | Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275) (Yeast) (Candida kefyr) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.345 |
| Instability index | 31.29 |
| Isoelectric point | 6.58 |
| Molecular weight | 17876.13 |
| Publications | PubMed=25834639
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | protein domain specific binding GO:0019904 IEA:EnsemblFungi
TFIID-class transcription factor complex binding GO:0001094 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to chemical stimulus GO:0010689 IEA:EnsemblFungi
negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels GO:0010691 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP33374
No repeats found
No repeats found
|