<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33373
| Description |
Mediator of RNA polymerase II transcription subunit 2 |
| Sequence | MAAKGVVAEKQDNKLTQCFDDILRLAADLLSQQQLKTIKLDPQVTTGFSQAQQKVLKDRLTHFYSLIDTLDVSLQTTAEYVDAVKANAIQIKKQREEEELRKQEQQKLEQQKLEQQKLEQQKLEQQKLEQQKLEQQKLEQQKLEQQKLEQQKLEQQKYSAKNTPMDMLTTFDSDLPSAGVAQPQGFNSDFGDLNGMDLSMFDSMDNQGSFGGLQSSSGMNEKKNDPQMNFNDTNAPPSAVAVPESENPNSYLTLNDFNDLGIDWNAANDNNELNLEDFNL |
| Length | 280 |
| Position | Tail |
| Organism | Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275) (Yeast) (Candida kefyr) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.935 |
| Instability index | 46.11 |
| Isoelectric point | 4.53 |
| Molecular weight | 31811.94 |
| Publications | PubMed=25834639
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33373
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.57| 19| 19| 104| 122| 1
---------------------------------------------------------------------------
104- 122 (39.06/19.97) EQQKLEQQKLEQQKLEQQK
124- 142 (39.06/19.97) EQQKLEQQKLEQQKLEQQK
144- 157 (23.45/ 9.37) EQQKLEQQKLEQQK.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.36| 12| 18| 247| 258| 2
---------------------------------------------------------------------------
247- 258 (23.96/15.72) NPNSYLTLNDFN
268- 279 (22.40/14.22) NDNNELNLEDFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.91| 24| 29| 165| 188| 4
---------------------------------------------------------------------------
165- 188 (44.46/28.69) MDMLTTF.DS.DLPSA..GVAQPQGFNS
196- 221 (31.39/18.26) MD.LSMF.DSmDNQGSfgGLQSSSGMNE
224- 244 (25.06/13.21) NDPQMNFnDT.NAPPS..AVAVPE....
---------------------------------------------------------------------------
|