<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33368

Description Mediator of RNA polymerase II transcription subunit 3
SequenceMGPDSMSGGHNSAGVTGVEILKENLTFETFREKIIEKDSNGDEVKEKVLETKAELDPIRGLMLEFVTMLANLESMSNKTSQEKFLAVRVKLIELQNKIQKFSKDFQQLQPLIQTMERFNEEIAGEKKYFVQETLGYASANPTSSSAGGGTSASTSASAQSKTTKKASGGRRNSAKKGNAVSASSTPNLKQIPNNQPQQQQPQAQIPQQPQIPQQPQQQPQIPQQMQIPMQMQMQMMPGVSPMAMASPLNNISPQRKLATTMNQSRENSLHQNQNQGQTPAGPMITPQNILNMSAFDMNQNQTPQPPNNINNMDLANLDLDSLNMEFLN
Length328
PositionTail
OrganismKluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275) (Yeast) (Candida kefyr)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
Aromaticity0.04
Grand average of hydropathy-0.759
Instability index57.85
Isoelectric point6.78
Molecular weight36173.48
Publications
PubMed=25834639

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33368
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.04|      13|      18|     137|     149|       3
---------------------------------------------------------------------------
  137-  149 (23.96/15.47)	ASA.NPTSSSAGGG
  156-  169 (18.08/ 9.97)	ASAqSKTTKKASGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.20|      15|      16|      64|      78|       4
---------------------------------------------------------------------------
   64-   78 (24.37/16.37)	EFVTMLANLESMSNK
   83-   97 (22.83/14.95)	KFLAVRVKLIELQNK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33368 with Med3 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TLGYASANPTSSSAGGGTSASTSASAQSKTTKKASGGRRNSAKKGNAVSASSTPNLKQIPNNQPQQQQPQAQIPQQPQIPQQPQQQPQIPQQMQIPMQMQMQMMPGVSPMAMASPLNNISPQRKLATTMNQSRENSLHQNQNQGQTPAGPMITPQNILNMSAFDMNQNQTPQPPNNINNMDLANLD
133
318










Molecular Recognition Features






MoRF SequenceStartStop




NANANA