<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33368
Description |
Mediator of RNA polymerase II transcription subunit 3 |
Sequence | MGPDSMSGGHNSAGVTGVEILKENLTFETFREKIIEKDSNGDEVKEKVLETKAELDPIRGLMLEFVTMLANLESMSNKTSQEKFLAVRVKLIELQNKIQKFSKDFQQLQPLIQTMERFNEEIAGEKKYFVQETLGYASANPTSSSAGGGTSASTSASAQSKTTKKASGGRRNSAKKGNAVSASSTPNLKQIPNNQPQQQQPQAQIPQQPQIPQQPQQQPQIPQQMQIPMQMQMQMMPGVSPMAMASPLNNISPQRKLATTMNQSRENSLHQNQNQGQTPAGPMITPQNILNMSAFDMNQNQTPQPPNNINNMDLANLDLDSLNMEFLN |
Length | 328 |
Position | Tail |
Organism | Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275) (Yeast) (Candida kefyr) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.759 |
Instability index | 57.85 |
Isoelectric point | 6.78 |
Molecular weight | 36173.48 |
Publications | PubMed=25834639
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33368
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.04| 13| 18| 137| 149| 3
---------------------------------------------------------------------------
137- 149 (23.96/15.47) ASA.NPTSSSAGGG
156- 169 (18.08/ 9.97) ASAqSKTTKKASGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.20| 15| 16| 64| 78| 4
---------------------------------------------------------------------------
64- 78 (24.37/16.37) EFVTMLANLESMSNK
83- 97 (22.83/14.95) KFLAVRVKLIELQNK
---------------------------------------------------------------------------
|