<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33355
| Description |
Uncharacterized protein |
| Sequence | MAPPRGRGGGSYSGGGSFSGGGGSGGFRGGRGDRGRGRGGGGRGGDRGTPFKARGGGRGGRGGGRGGGRGGGRGGGMKGGSRVVVQPHRHEGIFIAKGKEDALVTKNLVPGEAVYNEKRITVQNEDSSKVEYRIWNPFRSKLAAAILGGVDNIWIKPGARVLYLGAASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILGLNASYYLKTGGHFVISIKANCIDSTVPAEAVFESEVNKLKADQFKPFEQVTLEPFERDHACVVGGYRMPKKKKDTA |
| Length | 321 |
| Position | Unknown |
| Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.438 |
| Instability index | 31.72 |
| Isoelectric point | 10.16 |
| Molecular weight | 33808.94 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | methyltransferase activity GO:0008168 IEA:UniProtKB-KW
RNA binding GO:0003723 IEA:UniProtKB-KW
|
| GO - Biological Process | methylation GO:0032259 IEA:UniProtKB-KW
rRNA processing GO:0006364 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP33355
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 95.64| 15| 16| 34| 48| 1
---------------------------------------------------------------------------
15- 29 (30.21/ 8.08) GGSFSGGGGSGGFRG
34- 48 (34.99/10.52) RGRGRGGGGRGGDRG
52- 66 (30.44/ 8.20) KARGGGRGGRGGGRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.03| 17| 18| 202| 218| 2
---------------------------------------------------------------------------
182- 205 (20.30/12.81) TGVVYAVEfshrsgrDLVNMAKKR
206- 222 (30.72/22.74) TNVIPIIE.......DARHPAKYR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.71| 13| 18| 73| 85| 4
---------------------------------------------------------------------------
73- 85 (23.36/12.11) RGGGM...KGGSRVVV
89- 104 (17.34/ 6.95) RHEGIfiaKGKEDALV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 107.27| 37| 159| 109| 149| 5
---------------------------------------------------------------------------
109- 149 (50.55/43.40) VPGEAVYnEKRITVQNEDSSK.VEYRiwNPFRSKlAAAILGG
271- 310 (56.71/38.57) VPAEAVF.ESEVNKLKADQFKpFEQVtlEPFERD.HACVVGG
---------------------------------------------------------------------------
|