<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33335
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPIRCILHWQPNQGTMVNSQILNEISQCVESLNGVKEGRCKASLTFYRPNLRDPSTAIDFPRDFLGISMLEQPNKYYFIIRGHKLVVEADYSILTIMEKLQSYKSKVALHFEGALYKLGDFQVRVIKVVPNQAESLRGIMIEIEYLPISSVEKSKPIMEDFIDLWKEVVSKKSLAGQFIHTEPNYAEYGLSDNYTSQHTAVQYAAALAQLIQSSQLRN |
| Length | 218 |
| Position | Head |
| Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.197 |
| Instability index | 41.34 |
| Isoelectric point | 6.96 |
| Molecular weight | 24879.37 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33335
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.30| 13| 15| 174| 186| 1
---------------------------------------------------------------------------
174- 186 (24.49/12.54) LAGQFI..HTEPNYA
190- 204 (18.82/ 8.59) LSDNYTsqHTAVQYA
---------------------------------------------------------------------------
|