<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33325
| Description |
Uncharacterized protein |
| Sequence | MDNNNWRPNQGTEANMDASDWRGGVPQELRQRIVNKILDTLKRRLPVSGQEGFLELQKIAERFEEKVFTAATSQSDYLRKIALKMLTMETTSQGTMANSPNQGAHDPGLVIPPHVHNPGQQHSIPMPNQSQSSGLTHTPIQNVGQNMPGENSVSGETHFLYHFI |
| Length | 164 |
| Position | Tail |
| Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.741 |
| Instability index | 50.45 |
| Isoelectric point | 6.37 |
| Molecular weight | 18297.27 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33325
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.57| 20| 20| 118| 137| 1
---------------------------------------------------------------------------
118- 137 (39.87/17.81) PGQQHSIPMPNQSQSSGLTH
139- 158 (36.70/15.97) PIQNVGQNMPGENSVSGETH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.98| 18| 21| 41| 60| 2
---------------------------------------------------------------------------
41- 60 (25.61/24.67) LKRRL..PVSGQEGFleLQKIA
63- 82 (23.37/15.40) FEEKVftAATSQSDY..LRKIA
---------------------------------------------------------------------------
|