<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33320

Description Uncharacterized protein
SequenceMEGTGGAAVAAAAAAGGEGEDRLNQAVQQQLNLKQVKTRAISLFKAISRILEDFEAYGRTNTTPKWQDILGQYSMVNLELFNIVDDMKKVSKAFVVHPKNVNAENATILPVMLSSKLLPEMEAEENSKREQLLVGMQNQNLPIPTQIEKLKARLDMIAAACEGAEKVLADTRKAYCFGTRQGPIAPTLDKGQAAKIQEQENLLRAAVNAGEGLRIPPDQRQITTAPPIHLADALPGLNDPPSHDASSVTNTMYIKNTPLSSNSMPQNPMLQTSASQLLGRSAASPSAPTATTSFDNTTPSPIPYANSPRSSTNIMNTPSPQQQTPQQQPQVQQQQQQRQKLMQLPQQQQQQMLAQQQQLRQSAMQGLGQLHGHQMQFSQPLGHQQFPGRQLSSGHVQHGIGQNQLNQGNQMTRLSQFSGPANSALFSAAQTTPNTQMIQNISGTLPSQSLLPRMQFGLSGNNPQRSHTSQMLSDQMFNMGGGNPGGMMPIQQQQQQHGSQAFGSMASNAQNLQSGMVTLQNTQQNHPNFSQQRQQNQQ
Length538
PositionHead
OrganismPhaseolus vulgaris (Kidney bean) (French bean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus.
Aromaticity0.04
Grand average of hydropathy-0.672
Instability index49.60
Isoelectric point9.28
Molecular weight58610.19
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33320
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.21|      16|      16|     284|     299|       3
---------------------------------------------------------------------------
  251-  271 (21.48/ 7.40)	TMYIKNTPLssnsmP....QNPMLQ
  292-  311 (22.73/ 8.24)	TSFDNTTPS.....PipyaNSPRSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     104.32|      23|     144|     342|     367|       4
---------------------------------------------------------------------------
  342-  364 (42.95/11.78)	MQLPQQQQQQ.......MLAQQQQLRQSAM
  404-  425 (29.35/ 6.96)	.QLNQGNQMT.......RLSQFSGPANSAL
  488-  516 (32.02/11.74)	MPIQQQQQQHgsqafgsMASNAQNL.QSGM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      54.20|      10|      39|     436|     446|       6
---------------------------------------------------------------------------
  436-  446 (14.69/10.84)	QMIqNISGTLP
  455-  463 (17.75/ 8.06)	QF..GLSGNNP
  475-  484 (21.76/11.59)	QMF.NMGGGNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.96|      16|      21|     198|     217|       7
---------------------------------------------------------------------------
  191-  206 (23.33/ 7.21)	GQAAKI.QEQENLLRAA
  210-  226 (23.63/21.65)	GEGLRIpPDQRQITTAP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33320 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AAVNAGEGLRIPPDQRQITTAPPIHLADALPGLNDPPSHDASSVTNTMYIKNTPLSSNSMPQNPMLQTSASQLLGRSAASPSAPTATTSFDNTTPSPIPYANSPRSSTNIMNTPSPQQQTPQQQPQVQQQQQQRQKLMQLPQQQQQQMLAQQQQLRQSAMQGLGQLHGHQMQFSQPLGHQQFPGRQLSSGHVQHGIGQNQLNQGNQMTRLSQFSGPANSALFSAAQTTPNTQMIQNISGTLPSQSLLPRMQFGLSGNNPQRSHTSQMLSDQMFNMGGGNPGGMMPIQQQQQQHGSQAFGSMASNAQNLQSGMVTLQNTQQNHPNFSQQRQQNQQ
205
538










Molecular Recognition Features






MoRF SequenceStartStop




NANANA