<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33307
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASKNESDNSTDTSPSSPKNIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPTNKELAHRQQFYFWKNYRNNRLKHILPRSLPEPSATSAVPAPVSTTTQAPVSALPPVPATSVAVTSTPAQAPSPMPYGMPPGSGLAKNDMRNPTVDNRRKRK |
Length | 207 |
Position | Middle |
Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.691 |
Instability index | 62.98 |
Isoelectric point | 9.37 |
Molecular weight | 23744.66 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33307
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.19| 19| 22| 140| 161| 1
---------------------------------------------------------------------------
140- 161 (27.49/21.04) ATSAvpAPVSTTTQAPvSALP...P
164- 185 (32.70/15.12) ATSV..AVTSTPAQAP.SPMPygmP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.57| 20| 27| 32| 51| 2
---------------------------------------------------------------------------
32- 51 (36.56/21.62) FLLELEFVQCLANPTYIHYL
62- 81 (39.01/23.45) FIGYLKYLQYWQRPEYIKFI
---------------------------------------------------------------------------
|