<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33299
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQVNLIAHLAFNTIGTLQRDAPPNRLSPNYPEPPAHPTEEGTNFSEQPKLMSSTLVKAAKQFDALVAALPISESGEEAQLKRIRELQAENDAIGQELQKQLEAAEKELNQVQELFSQASDNCLNLKKPDDN |
| Length | 139 |
| Position | Middle |
| Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.639 |
| Instability index | 55.34 |
| Isoelectric point | 4.58 |
| Molecular weight | 15404.02 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
polar nucleus GO:0043078 IEA:EnsemblPlants
|
| GO - Biological Function | |
| GO - Biological Process | defense response to fungus GO:0050832 IEA:EnsemblPlants
|
Interaction
Repeat regions
| Repeats |
>MDP33299
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.26| 26| 27| 71| 96| 1
---------------------------------------------------------------------------
43- 66 (19.90/ 9.31) .....AHPTEEGtnfSEQPKLMSSTLV..KA
71- 96 (39.58/24.99) DALVAALPISES...GEEAQLKRIREL..QA
99- 126 (32.78/19.58) DAIGQELQKQLE...AAEKELNQVQELfsQA
---------------------------------------------------------------------------
|