Description | Uncharacterized protein |
Sequence | MDIISQLQEQVNLIAHLAFNTIGTLQRDAPPNRLSPNYPEPPAHPTEEGTNFSEQPKLMSSTLVKAAKQFDALVAALPISESGEEAQLKRIRELQAENDAIGQELQKQLEAAEKELNQVQELFSQASDNCLNLKKPDDN |
Length | 139 |
Position | Middle |
Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.639 |
Instability index | 55.34 |
Isoelectric point | 4.58 |
Molecular weight | 15404.02 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule polar nucleus GO:0043078 IEA:EnsemblPlants |
GO - Biological Function | |
GO - Biological Process | defense response to fungus GO:0050832 IEA:EnsemblPlants |
Binary Interactions |
Repeats | >MDP33299 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 92.26| 26| 27| 71| 96| 1 --------------------------------------------------------------------------- 43- 66 (19.90/ 9.31) .....AHPTEEGtnfSEQPKLMSSTLV..KA 71- 96 (39.58/24.99) DALVAALPISES...GEEAQLKRIREL..QA 99- 126 (32.78/19.58) DAIGQELQKQLE...AAEKELNQVQELfsQA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEAQLKRIRELQAENDAIGQELQK 2) FSEQPKLMSSTLVKAAKQFDALVAALPI | 84 52 | 107 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab