<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33295
Description |
Uncharacterized protein |
Sequence | MAANFWTSSHYKHLLDQEDVDMVNALDKEKGITLEDFKLIKMNMTNYILKLAQQVKVRQRVVATAVTYMRRVYTKKSMAEYDPRLVAPTCLYLASKAEESTVQARLLVFYIKKLYADEKYRYEIKDILEMEMKILEALNYYLVVYHPYRSLSPLLQDAGLNDLNMTQLTWGLVNDTYKMDLILVHPPHLIALACIYIASVLRDKDTTAWFEELRVDMNVVSVPRYF |
Length | 226 |
Position | Kinase |
Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.086 |
Instability index | 33.08 |
Isoelectric point | 6.96 |
Molecular weight | 26497.68 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33295
No repeats found
|