<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33287
| Description |
Uncharacterized protein |
| Sequence | MDLDDFRSILDTSGVDVWMFIDAAIAVASADCAAELKRRRDSIVESLYSATAAPPRCRNCDDGHLLRTNGHQITKQNSPSPSPVRQPHRRRAAEAANSPATPQSLENDDGGEDLDPYGGLFDDEQKKILEIKEQLEEPDQSEDSLVELLQSLADMDITFQALKETDIGRHVNRLRKHPSNDVRRLVKLLVRKWKEIVDEWVKLKPQGGRDTLMADGDSPVQKTTQNGHHHQIPDFAYSPNPHNGSSGSDRNNSEAEHKPKVIPRSEPRPKPTPAPSISTPASASQNRQRDSSFDAERLASARRRLQENYKEAENAKRQRTIQVMDINELPKSKPKNAFFGKNKGGGGSQGRHW |
| Length | 353 |
| Position | Unknown |
| Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.002 |
| Instability index | 61.39 |
| Isoelectric point | 6.85 |
| Molecular weight | 39480.34 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33287
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 149.81| 27| 27| 215| 241| 1
---------------------------------------------------------------------------
55- 81 (31.41/15.32) ....PRCRNCDDGHllrtnGHQ..ITK.QNSP.SP
83- 102 (27.02/12.15) PVRQPHRRRAAEA...............ANSPaTP
215- 241 (49.94/28.71) DGDSPVQKTTQNGH.....HHQ..IPDFAYSP.NP
243- 271 (41.43/22.57) NGSSGSDRNNSEAE.....HKPkvIPRSEPRP.KP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.80| 11| 27| 103| 113| 3
---------------------------------------------------------------------------
103- 113 (19.98/12.57) QSLENDDGGED
133- 143 (19.83/12.42) EQLEEPDQSED
---------------------------------------------------------------------------
|