<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33275
| Description |
Uncharacterized protein |
| Sequence | MDPEGKKFGGGPRELTGAVDLISHFKLLPHYEFFCKRPLPVSIADTHYLHNVVGDTDIRKGDGMQLDQLIQYTSSFRDTNARMQPFDLDVLKEAFQLRETAPVDLPAAEKGIPTISGKSKSENKDKEKKHKKHKDKDKDKDKEHKKHKHRHKDRSKDKDKDKDRDKKKDKSGHRDSSADHSKKHHEKKRKHDGDDDVNDVHKHKRSKHKSSKIDELGAIKVAG |
| Length | 223 |
| Position | Head |
| Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.478 |
| Instability index | 31.67 |
| Isoelectric point | 9.51 |
| Molecular weight | 25639.56 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33275
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.19| 20| 21| 126| 146| 1
---------------------------------------------------------------------------
127- 146 (36.80/11.78) EKKHKKHKDKDKDKDKEHKK
186- 205 (31.39/ 6.26) EKKRKHDGDDDVNDVHKHKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 28.95| 9| 20| 76| 88| 5
---------------------------------------------------------------------------
76- 88 (12.73/19.80) FRDTnarmQPFDL
97- 105 (16.22/10.18) LRET....APVDL
---------------------------------------------------------------------------
|