<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33272
Description |
Uncharacterized protein |
Sequence | MWHLIVEACIARNLLDTSAYLWQGYTNGRINQIPQCMPAQILGWSSFMKGAPLTSMMVNALVSSPAICQVCQMLFFVNLPKGKAIEYTLLDLMEV |
Length | 95 |
Position | Tail |
Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.466 |
Instability index | 39.16 |
Isoelectric point | 6.51 |
Molecular weight | 10640.58 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33272
No repeats found
No repeats found
|