| Description | Uncharacterized protein |
| Sequence | MWHLIVEACIARNLLDTSAYLWQGYTNGRINQIPQCMPAQILGWSSFMKGAPLTSMMVNALVSSPAIWYVRCSFL |
| Length | 75 |
| Position | Tail |
| Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Phaseolus. |
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.408 |
| Instability index | 44.92 |
| Isoelectric point | 8.61 |
| Molecular weight | 8466.92 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP33271 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) WYVRCSFL 2) YLWQGY | 68 20 | 75 25 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab