<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33248

Description Mediator of RNA polymerase II transcription subunit 7
SequenceMADAAQQRALTAAFPPPPPFWKHFTPDNLQKFEEIKQEARGGENSKKNKKWTPAELQALQVPPELRFLVPPQVPGNGHYSVFGELQSLSTTLPSLKEQGIEQLYPSPPATEADDEQSQLRPARPLNHAYYLLKISKSLLLNFLEFIGILSVAPEQFEPKLEDMRNLFVNAHHLLNLYRPHQARESLILMMEEQLHKTKEEIEEIDQVKTKVETILQQLKNEGNDADTASRSSRNRSEADKELNKKAVEYAQQIWELLDDEIGTD
Length264
PositionMiddle
OrganismByssochlamys spectabilis (strain No. 5 / NBRC 109023) (Paecilomyces variotii)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Thermoascaceae> Byssochlamys.
Aromaticity0.07
Grand average of hydropathy-0.706
Instability index67.55
Isoelectric point5.23
Molecular weight30171.70
Publications
PubMed=24407650

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33248
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.25|      26|      53|      15|      66|       1
---------------------------------------------------------------------------
   15-   66 (39.28/49.14)	PPPPPFWKHFTpdnlqkfeeikqearggenskknkkwTPAELQALQVP.PELR
   70-   96 (43.97/17.99)	PPQVPGNGHYS..........................VFGELQSLSTTlPSLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     142.02|      42|      46|      99|     140|       3
---------------------------------------------------------------------------
   99-  140 (70.79/44.03)	GIEQLYPSPPATEADDEQSQLRPARPLNHAYYLLKISKSLLL
  147-  188 (71.23/44.34)	GILSVAPEQFEPKLEDMRNLFVNAHHLLNLYRPHQARESLIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.85|      15|      19|     191|     205|       4
---------------------------------------------------------------------------
  191-  205 (24.29/13.89)	EEQLHKTKEEIEEID
  212-  226 (24.55/14.11)	ETILQQLKNEGNDAD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33248 with Med7 domain of Kingdom Fungi
Unable to open file!