Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSVPVSTTSYQAGPLSPSSPAAGSFKATHPPPSIHTPQTPTSPPLMSVNYASSFTTTQASPGQATTSQTAPLSSPPSSTPMSTQLSQQPTVAATNSFPTPASSVSGHLMGTSSAEDLENAEKSGPMTDAHRSDHDRQQTGGQQKYSATVKSEGAMDVDGETGASRNEFTLSSLEKDFGPAFHLCKTFVNVCCVNAMLPLIAHTMTGPDPGWDLVSLYGLGPIAKSVARTDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHDPGAPGGLRDLTMWPEEEWQNQKVSGKEIQVADLDSAFYKLQMKAMKMEPGTVPNHEFWEDALGHEKPMKHAGPGDSKKVSAAATPNATRQPSQPNGTPTATEPERTRPSRGRKRHYDENSFVGYGEGYADDDDDAMYSNSESGKKRRKKDNIPRGPPMPERSGSYGVGMFGIGAR |
Length | 438 |
Position | Head |
Organism | Byssochlamys spectabilis (strain No. 5 / NBRC 109023) (Paecilomyces variotii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Thermoascaceae> Byssochlamys. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.767 |
Instability index | 48.20 |
Isoelectric point | 7.21 |
Molecular weight | 46732.44 |
Publications | PubMed=24407650 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33246 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 197.47| 48| 55| 4| 57| 1 --------------------------------------------------------------------------- 4- 51 (90.24/33.86) PVSTTSYQAGP.L.SPSSPAAGSFKATHPPP.....SIHTPQTPTSPPLMSVNYA 61- 114 (72.39/30.93) PGQATTSQTAP.LsSPPSSTPMSTQLSQQPTvaatnSFPTPASSVSGHLMGTSSA 334- 366 (34.84/ 8.58) ........AGPgD.SKKVSAAATPNATRQPS.....QPNGTPTATEP........ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 104.75| 30| 53| 208| 238| 2 --------------------------------------------------------------------------- 208- 238 (48.64/35.29) DPGWDlVSLYGLGPIAKSVARTDPVTGEKIN 263- 292 (56.11/36.50) DPGAP.GGLRDLTMWPEEEWQNQKVSGKEIQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AMYSN 2) GKKRRKKDNIPRGPPM | 398 406 | 402 421 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab