<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33240

Description "RNA polymerase II transcription mediator complex subunit Srb7, putative"
SequenceMADILTQLQTCLDQLATQFYATIGYLNTYHDHSPAIPPSDVPDAAPQLAKIPKNQHAHPVPATAAAQAKAAEQASPPPANASAANDPNAPPPPDSPRTFAARQRELARDLIIKEQQIEYLIKELPGIGSSEEEQEKRIQELGKELRDVGEEKERKVQELKALGRRLEKVLGAIETGIYGDEIPQR
Length185
PositionMiddle
OrganismByssochlamys spectabilis (strain No. 5 / NBRC 109023) (Paecilomyces variotii)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Thermoascaceae> Byssochlamys.
Aromaticity0.04
Grand average of hydropathy-0.666
Instability index61.44
Isoelectric point5.18
Molecular weight20252.53
Publications
PubMed=24407650

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	ARBA:ARBA00003669
ECO:0000256	RuleBase:RU366036
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33240
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      70.08|      16|      16|      55|      70|       1
---------------------------------------------------------------------------
   55-   70 (28.09/11.75)	QHAHPVPATAAA..QAKA
   72-   89 (21.49/ 7.54)	EQASPPPANASAanDPNA
   90-  104 (20.50/ 6.91)	PPPPDSPRTFAA..RQR.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.29|      22|      33|     106|     128|       3
---------------------------------------------------------------------------
  106-  128 (31.95/24.00)	LARDLI.IKEQQiEYLIKELPGIG
  141-  163 (30.34/18.01)	LGKELRdVGEEK.ERKVQELKALG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33240 with Med21 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) DHSPAIPPSDVPDAAPQLAKIPKNQHAHPVPATAAAQAKAAEQASPPPANASAANDPNAPPPPDSPRTFAARQRE
2) KELPGIGSSEEEQEKRIQELGKELRDVGEEKERKVQELK
31
122
105
160










Molecular Recognition Features






MoRF SequenceStartStop




NANANA