<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33240
| Description |
"RNA polymerase II transcription mediator complex subunit Srb7, putative" |
| Sequence | MADILTQLQTCLDQLATQFYATIGYLNTYHDHSPAIPPSDVPDAAPQLAKIPKNQHAHPVPATAAAQAKAAEQASPPPANASAANDPNAPPPPDSPRTFAARQRELARDLIIKEQQIEYLIKELPGIGSSEEEQEKRIQELGKELRDVGEEKERKVQELKALGRRLEKVLGAIETGIYGDEIPQR |
| Length | 185 |
| Position | Middle |
| Organism | Byssochlamys spectabilis (strain No. 5 / NBRC 109023) (Paecilomyces variotii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Thermoascaceae> Byssochlamys.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.666 |
| Instability index | 61.44 |
| Isoelectric point | 5.18 |
| Molecular weight | 20252.53 |
| Publications | PubMed=24407650
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33240
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 70.08| 16| 16| 55| 70| 1
---------------------------------------------------------------------------
55- 70 (28.09/11.75) QHAHPVPATAAA..QAKA
72- 89 (21.49/ 7.54) EQASPPPANASAanDPNA
90- 104 (20.50/ 6.91) PPPPDSPRTFAA..RQR.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.29| 22| 33| 106| 128| 3
---------------------------------------------------------------------------
106- 128 (31.95/24.00) LARDLI.IKEQQiEYLIKELPGIG
141- 163 (30.34/18.01) LGKELRdVGEEK.ERKVQELKALG
---------------------------------------------------------------------------
|