<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33232
| Description |
Uncharacterized protein |
| Sequence | MDLLTQLDSDIDLLLKIMSSSVAFISRKAKHAPLPSSSIPLTILGKTEAIEPEAMDEAISELVADLVEKAAGIREIIEHLPTKESLGGDVELQQELGRLEDEMRGVNEEYRAAVEECKVLQGEVGELVRLVSERQAEGRAWLVNELEGGKAIPNEGVEGRIA |
| Length | 162 |
| Position | Middle |
| Organism | Kalmanozyma brasiliensis (strain GHG001) (Yeast) (Pseudozyma brasiliensis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Kalmanozyma.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.161 |
| Instability index | 48.72 |
| Isoelectric point | 4.50 |
| Molecular weight | 17655.90 |
| Publications | PubMed=24356824
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33232
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.22| 22| 26| 92| 116| 1
---------------------------------------------------------------------------
92- 116 (34.75/26.27) LQQELGRLedeMRGVNE...EYRA.AVEE
120- 145 (28.48/14.40) LQGEVGEL...VRLVSErqaEGRAwLVNE
---------------------------------------------------------------------------
|