<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33225
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MSSAAGNRRPRQITPTSPSPSPEPQPGTTNGSTSIIATAPPPPTLPPASAPVTATSVDPTESVRASLETRVRSVVDLLYQLAVCSADVQDGSQHLVSAKVNECIAALAALDATKDDVHRAHMMVPQDVLEMLDTGKNPDIHTRNFVNRLASENQYSFGQHRAVERYKERLSSALDEAFPELRRAKEDVMEE |
Length | 191 |
Position | Middle |
Organism | Kalmanozyma brasiliensis (strain GHG001) (Yeast) (Pseudozyma brasiliensis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Kalmanozyma.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.488 |
Instability index | 52.86 |
Isoelectric point | 5.39 |
Molecular weight | 20667.87 |
Publications | PubMed=24356824
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33225
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.47| 15| 16| 35| 49| 2
---------------------------------------------------------------------------
35- 49 (28.12/12.55) IIATAPPPPTLPPAS
52- 66 (24.35/10.05) VTATSVDPTESVRAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.98| 14| 18| 148| 165| 4
---------------------------------------------------------------------------
148- 161 (25.57/23.97) RLASENQYSFGQHR
169- 182 (23.41/10.44) RLSSALDEAFPELR
---------------------------------------------------------------------------
|