<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33214
Description |
Uncharacterized protein |
Sequence | MHVSPLQWTFVTILCTPERPTASRSFFCPLEALLASLLLHQSEQTYINRERGSSVTVARMDPFSGSGSWNMMPSIPSHNSSPAASNQDNLFLSPQHQQQFYQQPTQFPQQQFQQQGRTPQQQQQPQQQQQQNQHHQSLASNFHLLHLMENLADAIENGTRDQQSDALVNELNNHFEKCQQLLSSISESLDTKAMVISIYLRHFIFLFNK |
Length | 209 |
Position | Middle |
Organism | Citrus clementina |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.629 |
Instability index | 71.50 |
Isoelectric point | 6.17 |
Molecular weight | 24007.51 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33214
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.45| 10| 30| 94| 103| 2
---------------------------------------------------------------------------
94- 103 (21.55/ 8.39) PQHQQQFYQQ
125- 134 (20.90/ 7.93) PQQQQQQNQH
---------------------------------------------------------------------------
|