<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33207
| Description |
Uncharacterized protein |
| Sequence | MELDQLFQTSSYVRQRDYSLCPFDLEVLGEAFRMRDLTPIDLPSVEKGIPTAVKPNSLSKDKEGQPRKHRVKYHGRNKHRHKYGISAENKKRGAHQYSVSEQLKNHLEKKRKHDGRGDLSVIHQNNGQITEKLLEFIKVSRNWDVDC |
| Length | 147 |
| Position | Head |
| Organism | Citrus clementina |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -1.056 |
| Instability index | 25.00 |
| Isoelectric point | 9.54 |
| Molecular weight | 17150.23 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33207
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.58| 10| 14| 16| 25| 1
---------------------------------------------------------------------------
16- 25 (20.66/13.97) RDYSLCPFDL
33- 42 (18.92/12.34) RMRDLTPIDL
---------------------------------------------------------------------------
|