Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAASKDNEEASDAPSSPKKVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPANKELAHRQQFFFWKNYRNNRLKHILPRPLPEPSEAPPPAAAPPLPPAPPVLTPVTAAPGPALSPMQYGIPPGSALMKNDMRSSSIDRRKRKKDG |
Length | 199 |
Position | Middle |
Organism | Citrus clementina |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.673 |
Instability index | 61.74 |
Isoelectric point | 9.24 |
Molecular weight | 22933.04 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33192 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.32| 19| 19| 129| 147| 1 --------------------------------------------------------------------------- 129- 147 (37.55/14.76) ILPRP..LPEPSEAPPPAAAP 149- 169 (31.77/11.55) LPPAPpvLTPVTAAPGPALSP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.57| 20| 27| 31| 50| 2 --------------------------------------------------------------------------- 31- 50 (36.56/23.51) FLLELEFVQCLANPTYIHYL 61- 80 (39.01/25.50) FIGYLKYLQYWQRPEYIKFI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ALMKNDMRSSSIDRR 2) NNRLK | 179 123 | 193 127 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab