<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33189
Description |
Uncharacterized protein |
Sequence | MDDQEQQDQQHQVDQQMQSVQQQAEIEDMIACVNVMDEALLPCLTELDLNKALVPDFEAPLTDFDEPAVQPAVETELQASDDFPPPLDHQTDVEKHARNFMEAAKKLQEYFICLQRENKPTKAEILKREIDAMEEELKIKDELVQKQEKVIQEWKKELRDRLDKHNVELERV |
Length | 172 |
Position | Head |
Organism | Citrus clementina |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.859 |
Instability index | 60.17 |
Isoelectric point | 4.41 |
Molecular weight | 20166.44 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33189
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.77| 24| 27| 37| 63| 1
---------------------------------------------------------------------------
37- 63 (35.47/25.95) DE.ALLPCLtELDLNKAlvPDFEAPL...TD
65- 92 (35.30/17.06) DEpAVQPAV.ETELQAS..DDFPPPLdhqTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.13| 17| 29| 101| 119| 2
---------------------------------------------------------------------------
101- 119 (23.36/23.50) MEAAKKLQEYFIclQRENK
133- 149 (26.77/17.84) MEEELKIKDELV..QKQEK
---------------------------------------------------------------------------
|