<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33181

Description Uncharacterized protein (Fragment)
SequenceMEESSGRTAMSGPREDPSEWKAKFTPDLRRKVVQKILDFIRMPPEARSQMTKVIEQFEEGLFRSAISQEDYLQKISRKLKLIDHKSSHSNAGVSSPSKPVLNQNSMVAVRGQSSSLKNVYQVPSKVAGDSVGQGMQSNISAANERNGLGTRQDQHQQSQQQLLTHIVHQPNAGNLCIEDILSVHCYQQQQNIASQSNSFQFSQNQTLNTESQQPPFSEQSSTAVFQPNQLVPQGNNIGQQLSPFQKTMPNSYQQPDGLQSNASCLQQQHRVTGAELKVMNMKSHEHSAHILQVEDTSLPSKVEQSVQSVNNFHQLLYSPKQSKKETTHQRPDTLDAMVTPQIVNNQQNVLLAVKNMTEVSSETGAPSEQANMAEFHDQMYQKFQAMRKEYLPWLTHVYNKLNEKCQK
Length407
PositionTail
OrganismCitrus clementina
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
Aromaticity0.05
Grand average of hydropathy-0.822
Instability index69.43
Isoelectric point8.23
Molecular weight45855.74
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33181
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      97.35|      24|      25|     195|     218|       1
---------------------------------------------------------------------------
  146-  165 (25.81/ 7.90)	..NGLGTRQDQ..HQQ..SQQQLLTH
  169-  194 (29.65/10.00)	QPNAGNLCIEDILSVHcyQQQQNIAS
  195-  218 (41.89/16.69)	QSNSFQFSQNQTLNTE..SQQPPFSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     113.29|      32|      74|     228|     259|       2
---------------------------------------------------------------------------
  228-  259 (60.54/33.12)	NQLVPQGNNIGQQL.SPFQKTMPNSYQQPDGLQ
  303-  335 (52.75/27.96)	EQSVQSVNNFHQLLySPKQSKKETTHQRPDTLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.00|      17|      17|      92|     108|       3
---------------------------------------------------------------------------
   92-  108 (30.42/16.22)	GVSSPSKPVLNQNSMVA
  111-  127 (29.59/15.61)	GQSSSLKNVYQVPSKVA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.91|      17|      19|      23|      39|       4
---------------------------------------------------------------------------
   23-   39 (28.08/16.83)	KFTPDLRRKVVQKILDF
   41-   57 (29.83/18.26)	RMPPEARSQMTKVIEQF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33181 with Med15 domain of Kingdom Viridiplantae
Unable to open file!