<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33168
| Description |
Uncharacterized protein |
| Sequence | MCKSLKLVKELNQLIPILQSNAEMGISRGNPLSTQNVMTSRQKGVAGLDPSDWRNQLSQESRRRIVNKIMDTLKRHLPFSSPEGLNELKNMAGRFEEKIYTSATSQSDYLRKISLKMLSMESRSQNAMPNPLQSNNASRSNEPPHPGSDVEFNAASLSICL |
| Length | 161 |
| Position | Tail |
| Organism | Citrus clementina |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.644 |
| Instability index | 65.89 |
| Isoelectric point | 9.59 |
| Molecular weight | 18004.35 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33168
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.14| 22| 59| 51| 74| 1
---------------------------------------------------------------------------
51- 74 (35.74/23.94) SDW.R....NQLSQESRRRivNKIMDTLK
107- 133 (31.40/15.68) SDYlRkislKMLSMESRSQ..NAMPNPLQ
---------------------------------------------------------------------------
|