Description | Uncharacterized protein |
Sequence | MATPPPGANLEGAPPAAPPPPGTDMTGICFRDQLWLNTYPLDRNMIFDYFTLSLFYDRTCNNEQLRMRSIHPLDISQLSKMTGIEYMLSEVMEPHLFVIRKQKRDGPEKVTPMLTYYVLDGSIYQAPQLCNVFSARIGRALHYIQKAFTTAASKLEKIGYVDAENDGGTPLHSKAGKETIDLKEVKRVDQILASLQRKLPPAPPPPPFPEGYAPPQTEEAEKDPETQQTAEPQPPAIDPIIDQGPAKRVKI |
Length | 251 |
Position | Head |
Organism | Citrus clementina |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.504 |
Instability index | 55.30 |
Isoelectric point | 5.65 |
Molecular weight | 27997.78 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33151 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.03| 14| 29| 29| 42| 2 --------------------------------------------------------------------------- 29- 42 (29.37/19.40) CFRDQLWLNT.YPLD 60- 74 (23.67/14.44) CNNEQLRMRSiHPLD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AIDPIIDQGPAKRVKI 2) EAEKDPET 3) EGYAPPQT 4) ILASLQRK | 236 219 210 191 | 251 226 217 198 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab