| Description | Uncharacterized protein |
| Sequence | MATPPPGANLEGAPPAAPPPPGTDMTGICFRDQLWLNTYPLDRNMIFDYFTLSLFYDRTCNNEQLRMRSIHPLDISQLSKMTGIEYMLSEVMEPHLFVIRKQKRDGPEKVTPMLTYYVLDGSIYQAPQLCNVFSARIGRALHYIQKAFTTAASKLEKIGYVDAENDGGTPLHSKAGKETIDLKEVKRVDQILASLQRKLPPAPPPPPFPEGYAPPQTEEAEKDPETQQTAEPQPPAIDPIIDQGPAKRVKI |
| Length | 251 |
| Position | Head |
| Organism | Citrus clementina |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.504 |
| Instability index | 55.30 |
| Isoelectric point | 5.65 |
| Molecular weight | 27997.78 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP33151
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.03| 14| 29| 29| 42| 2
---------------------------------------------------------------------------
29- 42 (29.37/19.40) CFRDQLWLNT.YPLD
60- 74 (23.67/14.44) CNNEQLRMRSiHPLD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AIDPIIDQGPAKRVKI 2) EAEKDPET 3) EGYAPPQT 4) ILASLQRK | 236 219 210 191 | 251 226 217 198 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab