Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MDPQTQNTSLQRLQNVERRVVRVLDIAGGVMDELASPSGPKKEFINSHCREFMQSMKDIQVTLREEIKSVCEYRPFEKCDYNARIANEICLQKLEYVLTQLDDLKKTADRYPSSG |
Length | 115 |
Position | Head |
Organism | Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Eutremeae> Eutrema. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.648 |
Instability index | 44.61 |
Isoelectric point | 5.86 |
Molecular weight | 13300.04 |
Publications | PubMed=23518688 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33145 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KTADRYPSSG 2) PKKEFINSHCREF 3) RIANEICLQKL 4) RLQNVERRVVRVLD 5) YRPFEK | 106 40 84 12 73 | 115 52 94 25 78 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab