<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33134

Description Uncharacterized protein (Fragment)
SequenceMWLPKVTDATIKGTRSGLVAVAIDRDKTSQNALKWTMDNLTSRGQTLALIHVAPKSQSSSDIEEGILHKQQMEKQTKDLFVSFHCYCSRKEINCMDVLLEDVDKVKAIVEYVTVSAIENLVLGAPSRNSFMRRFKTDLPTSVSKAAPDFCNVYVISKGKISSVRNASRPAPYRSSVPSEFDNNHETFANQKKHKTGFAKPPQAHMRLMGDFSDSESEFSFISASQHESDISFASSGRPSADRSSFTYDLPESARTSRMSTSSEQSIGSHRLGIKFTDLGYLNNSSTVSDESGRTSCSYSSQSLDDVEAQMRRLRLELKQTMDMYSSACREALTARHEATELQKLRSEEERRMEELKMTEETAMSMVEKERAKAKTAMEAAEAANRLAEVEAKKRLTAEMKALKESGSFSRHSIVRYRKYTVQEIEEATGNFADSRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHKEVEVLSCIRHPNMVLLLGACPEYGILVYEYMAKGSLDDRLFRRGNTPPISWQLRFRIAAEIATGLLFLHQTKPEPIVHRDLKPGNVLLDHNYVSKISDVGLARLVPAVAENVTQYRVTSAAGTFCYIDPEYQQTGMLGVKSDVYSLGIMLLQLLTAKQPMGLAYYVEQAIEEGTLKDMLDPAVPDWPLEEALSLAKLSLQCAELRRKDRPDLGKEVMPELNRLREIGEESLESVFYSGQG
Length713
PositionTail
OrganismEutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Eutremeae> Eutrema.
Aromaticity0.07
Grand average of hydropathy-0.449
Instability index50.71
Isoelectric point6.66
Molecular weight79706.58
Publications
PubMed=23518688

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP33134
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     258.17|     100|     167|     413|     522|       1
---------------------------------------------------------------------------
  413-  491 (85.09/92.56)	.............................................................................................IVRYRkytvqeI.EEATGNF..ADSRKVGEGGYGPVFrgHLDHTSVAVKVLRPDAAQGRSQFHKEVEvlSCIRHPNMVLLLG
  492-  522 (25.38/ 9.40)	ACPEYGILVYEYMAKGSLDDRLFRRGNTPPI................................................................................................................................................
  585-  653 (86.70/65.02)	...............................swqlrfriaaeiatgllflhqtkpepivhrdlkpgnvlldhnyvskisdvglarlvpavaenVTQYR......V.TSAAGTFcyIDPEYQQTGMLGV....KSDVYSLGIMLLQLLTAKQPMGLAYYVE..QAIEEGTLKDMLD
  655-  708 (60.99/41.77)	AVPDWPLEEALSLAKLSLQCAELRRKDRPDL..........................................................................gKEVMPEL..NRLREIGEESLESVF.............................................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     155.13|      40|      73|     212|     253|       2
---------------------------------------------------------------------------
  162-  183 (20.97/10.00)	...............SVR.............NASRPAPYRSS....VP.SE.fDNN
  184-  215 (43.72/32.40)	HE.TFANQKKHKT..GFA................KPPQAHMRLMGD.....fsDSE
  216-  253 (54.27/45.18)	SEFSFISASQHESDISFA.............SSGRPSADRSSFTYDLPeSA.....
  259-  304 (36.17/23.01)	STSSEQSIGSHRLGIKFTdlgylnnsstvsdESGRTSCSYSSQSLD..........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     142.63|      44|     282|      33|      76|       3
---------------------------------------------------------------------------
   33-   76 (74.87/48.07)	LKWTMDNLTSR.GQTLALIHVAPKSQSSSDIEEGILHKQQMEKQT
  317-  361 (67.76/42.85)	LKQTMDMYSSAcREALTARHEATELQKLRSEEERRMEELKMTEET
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP33134 with Med32 domain of Kingdom Viridiplantae

Unable to open file!