<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33127
| Description |
Uncharacterized protein (Fragment) |
| Sequence | LIEKLSKEIETGGSDSLVSELKIRFKNCEQMLNSISRSIGSKAMTVDGQKRKLEESEYLLEQRRLFYNKNIVSHPKSKKPEEEIN |
| Length | 85 |
| Position | Middle |
| Organism | Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Eutremeae> Eutrema.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.838 |
| Instability index | 71.72 |
| Isoelectric point | 8.75 |
| Molecular weight | 9828.14 |
| Publications | PubMed=23518688
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33127
No repeats found
No repeats found
|