<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33110
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASPEEIDDTSEIPSPTKNTYKDPDGGRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNPNFRSAMAHPANKELAHRQQFYYWKNYRNNRLKHILPRPLPEPIAPQPPAAPSATLPPAPSVSVALSPSLSPMQYNNMLSKNEPRNMASAGIDRRKRKKVP |
| Length | 195 |
| Position | Middle |
| Organism | Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Eutremeae> Eutrema.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.701 |
| Instability index | 67.19 |
| Isoelectric point | 9.24 |
| Molecular weight | 22801.86 |
| Publications | PubMed=23518688
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33110
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 166.92| 45| 46| 70| 115| 1
---------------------------------------------------------------------------
35- 68 (34.29/14.06) ..................LEFIQCLANPTYIHYLAQNRYFEdeafIGYLKYL
70- 115 (80.79/47.87) YWQ..RPEYIKFIMyPHCLYFLELLQNPNFRSAMAHPANKE....LAHRQQF
117- 153 (51.83/25.31) YWKnyRNNRLKHIL.PRPLPEPIAPQPPAAPSATLPPA..............
---------------------------------------------------------------------------
|