Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASPEEIDDTSEIPSPTKNTYKDPDGGRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNPNFRSAMAHPANKELAHRQQFYYWKNYRNNRLKHILPRPLPEPIAPQPPAAPSATLPPAPSVSVALSPSLSPMQYNNMLSKNEPRNMASAGIDRRKRKKVP |
Length | 195 |
Position | Middle |
Organism | Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Eutremeae> Eutrema. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.701 |
Instability index | 67.19 |
Isoelectric point | 9.24 |
Molecular weight | 22801.86 |
Publications | PubMed=23518688 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33110 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 166.92| 45| 46| 70| 115| 1 --------------------------------------------------------------------------- 35- 68 (34.29/14.06) ..................LEFIQCLANPTYIHYLAQNRYFEdeafIGYLKYL 70- 115 (80.79/47.87) YWQ..RPEYIKFIMyPHCLYFLELLQNPNFRSAMAHPANKE....LAHRQQF 117- 153 (51.83/25.31) YWKnyRNNRLKHIL.PRPLPEPIAPQPPAAPSATLPPA.............. --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ASAGIDRRKRK 2) YYWKNYR | 182 116 | 192 122 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab