<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33095
| Description |
Uncharacterized protein |
| Sequence | MGPSGEPTMETNTNDWRTQLPPDARQKIINKIWETLKKHIPFSKPEGDNELRRISIRFEEKIYSGAVDKNDYLRKISMKMLSMEAKSQNAAGSVSSIPAADDSLPLDLRHLVIDNGNSEPCLPKEEPAMNISDWRTHLPPDSRQRNVNKLMETLKKHVPYSGQEGIDELMRIAVSFEDLIFNTAINQVSLLIKLTCALTYLISSPFFLVLLIFCLLRVLGGLLAQDILIDADDGRGRLSKLRCNRSFAFEKFRIYLCYVSKEQTLKPLKVKA |
| Length | 272 |
| Position | Tail |
| Organism | Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Eutremeae> Eutrema.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.297 |
| Instability index | 39.45 |
| Isoelectric point | 8.71 |
| Molecular weight | 30908.51 |
| Publications | PubMed=23518688
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33095
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.85| 17| 20| 16| 32| 1
---------------------------------------------------------------------------
16- 32 (33.65/14.72) WRT...QLP...PDARQKIINKI
33- 54 (19.47/ 6.58) WETlkkHIPfskPEGDNE.LRRI
134- 150 (34.73/15.34) WRT...HLP...PDSRQRNVNKL
---------------------------------------------------------------------------
|