<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33073
| Description |
Uncharacterized protein |
| Sequence | MASNFWTSSHYKELKDPEEINVVHPLDAQRGISVEDFRLIKLHMSNYISKLAQHIKIRQRVVATAVTYMRRVYTRKSLTEYEPRLVAPTCLYLACKAEESVVHAKILVFYIKKLYADEKFRYEIKDILEMEMKILEALNFYLVVFHPYRSLPEFLQDSGISDTSMTHLTWGLVNDTYRMDLILTHPPYLISLACIYIASVYKEKDIRTWFEELSVDMNIVKNIAMEVLDFYENHRMFTEERVHAAFNKLATTNP |
| Length | 254 |
| Position | Kinase |
| Organism | Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Eutremeae> Eutrema.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.139 |
| Instability index | 39.11 |
| Isoelectric point | 6.56 |
| Molecular weight | 29962.44 |
| Publications | PubMed=23518688
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33073
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.87| 12| 101| 83| 94| 1
---------------------------------------------------------------------------
83- 94 (23.08/12.95) PRLVAPTCLYLA
187- 198 (22.79/12.73) PYLISLACIYIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.09| 26| 188| 9| 37| 2
---------------------------------------------------------------------------
9- 37 (39.19/43.44) SHYKElKDP....EEINVvhPLDAQRGISVE..DF
199- 230 (35.90/26.62) SVYKE.KDIrtwfEELSV..DMNIVKNIAMEvlDF
---------------------------------------------------------------------------
|